<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_42 GBS_42 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+DDI NA
3 AZT+DDC+RTV NA
4 3TC+D4T+RTV NA
5 3TC+D4T+NFV NA
6 3TC+AZT+RTV+SQV NA
7 3TC+AZT+EFV+LPV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219E K103N V108I E44D, I94IL, K122E, I135V, A158AS, E169D, D177E, G196E, I202IV  
>GBS_42| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGLPHP
AGLKKNKSVTILDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
SIFQSSMTKILDPFRKQNPEIVIYQYVDDLYVGSDLEIEQHRTKVEELRQHLWRWGFYTP
DEKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I47V, G48M, I54L, V82A, I84V, L90M L33F, F53L L10R, K14N, I15K, E34Q, N37D, L63P, A71V, V77I, I93L P9S
>GBS_42| codons 4-99
TLWQRSRVTINKGGQLKEALLDTGADDTVFQEMDLPGRWKPKMVMGIGGLLKVRQYDQIP
IEICGHKVIGTVLIGPTPANVIGRNLMTQLGCTLNF

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005