<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_35 GBS_35 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC+SQV NA
2 3TC+D4T+NFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V K219Q     K49Q, V106I, V118I, K122E, I135T, I178M, T200TA, F214L, L228H F124Y, P236T
>GBS_35| codons 38-247
CTEMEKEGKISQIGPENPYNTPVFAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSITVLDVGDAYFSIPLDEDYRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGLTTP
DQKHQKEPPFHWMGYELHTDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   L10LI, M36MI, I62V, L63P, I64V, T74A, V77VI  
>GBS_35| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADNTVLEEINLPGRWKPKMIGGIGGFIKVRQYDQVP
VEICGHKAIGAVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005