<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_34 GBS_34 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC+SQV NA
2 AZT+SQV NA
3 3TC+AZT+SQV NA
4 D4T+DDI+RTV+SQV NA
5 D4T+DDI+LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82CFIS, L90M Q58QE, G73GS, N88ND L10I, I13V, Q18H, K20M, L33V, N37T, I62V, L63P, A71V, C95L  
>GBS_34| codons 4-99
TLWQRPIVTVKIGGHLMEALLDTGADDTVVEEMTLPGRWKPKMIGGIGGFVKVREYDQVP
IEICGHKVISTVLVGPTPSNIIGRDLMTQIGLTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219Q     I135T, Q207R, V245T  
>GBS_34| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRRHLLRWGFTTP
DQKHQKEPPFLWMGYELHPDKWTVQPITLP

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005