<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_33 GBS_33 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+DDC+EFV+IDV+SQV NA
2 ABC+D4T+DDI+LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M L10F, L33F, Q58E I15L, I62V, L63P, A71T, I72V, Q92K, I93L  
>GBS_33| codons 4-99
TLWQRPFVTIKLGGQLKEALLDTGADDTVFEEMNLPGRWKPKIIGGIGGFVKVREYDQVP
IEICGHKTVGTVLVGPTPANIIGRNLMTKLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, T215F K219Q     T39A, K122E, I135T, V179I, R211K, D218E, V245K  
>GBS_33| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFFTP
EQKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005