<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_32 GBS_32 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+SQV NA
2 3TC+AZT+SQV NA
3 3TC+D4T+IDV NA
4 3TC+D4T+NFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M Q58E, T74TP L10I, G16A, K20R, E35D, M36I, N37D, I62V, L63P, A71V, I72IV, I93L, N98K W6W*S
>GBS_32| codons 4-99
TLSQRPIVTIKIAGQLREALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFVKVREYDQVP
IEICGHKVVGPVLVGPTPANIIGRNLMTQLGCTLKF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       T39S, E40D, K49R, R83K, L109MV, D121Y, K122E, G196E, I202V, Q207E V108L, A114R
>GBS_32| codons 38-247
CSDLEKEGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHP
AGLKKKKSVTLVDVGDRYFSVPLYEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKVEELREHLLRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005