<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_31 GBS_31 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC NA
2 3TC+AZT NA
3 3TC+AZT+IDV NA
4 3TC+AZT+NFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62V, V75I     E40ED, K43N, A98S, G196E, R211K, V245E  
>GBS_31| codons 39-247
TDMENEGKISKIGPENPYNTPVFVIKKKDSTKWRKLIDFRELNKRTQDFWEVQLGIPHPS
GLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPA
IFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIEELRQHLLKWGFTTPD
KKHQKEPPFLWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90LM   L10I, D60E, Q61E, I62V, L63P, I64L, V77I, I93L  
>GBS_31| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYEEVP
LEICGHKAIGTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005