<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_30 GBS_30 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI NA
2 AZT+DDI NA
3 3TC+D4T+SQV NA
4 3TC+D4T+RTV NA
5 D4T+DDI+NFV+NVP NA
6 D4T+DDI+EFV+IDV+RTV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N V108I, P225PH V60I, R83K, V90I, I135T, S162A, E169D, H221Y L120S
>GBS_30| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKKTQDFWEIQLGIPHP
AGLKKNKSVTILDVGDAYFSVPSDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILDPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTP
DKKYQKEHPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IL, V82VA, I84IV   G16E, I64IV, I72V, V77I, I93IL  
>GBS_30| codons 4-99
TLWQRPLVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFLKVRQYDQIL
VEICGHKAVGTVLIGPTPANVIGRNLLTQLGCTLNF

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005