<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_29 GBS_29 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 RTI NA
2 3TC+AZT+IDV 73
3 3TC+D4T+IDV 73
4 3TC+D4T+NFV 73
5 3TC+D4T+NFV 74

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L10F, Q58E, N88D W6WL, I13V, L63P, V77I, I93L  
>GBS_29| codons 4-99
TLLQRPFVTVKIGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVREYDQIP
IEICGHKAIGTVLIGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q K103N   V60I, T69TN, A98S, K102KR, D123E, I135V, D177N, G196E, R211K, L228H, V245T  
>GBS_29| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKRNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPNIVIYQYMDDLYVGSDLEIEQHRTKIEELRQHLLKWGFFTP
DQKHQKEPPFHWMGYELHPDKWTVQPITLP

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005