<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_28 GBS_28 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+DDI NA
3 3TC+AZT+SQV NA
4 D4T+DDI+NVP NA
5 D4T+DDI+NFV NA
6 3TC+D4T+IDV+RTV NA
7 3TC+D4T+LPV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V, L210W, T215Y V75M     K43N, V60I, R83K, K101Q, K104N, K122E, I142LV, S162Y, R211K A129V, F130I
>GBS_28| codons 38-247
CTEMENEGKISKIGPENPYNTPIFAIKKKNSTKWRKLMDFRELNKKTQDFWEVQLGIPHP
AGLQKKNSVTVLDVGDAYFSVPLDEDFRKYTVITIPSINNETPGVRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M F53L, G73S L10I, T12K, I13V, Q18K, L19Q, K20I, M36I, N37T, R41K, K55R, I62V, L63P, A71V, T74S  
>GBS_28| codons 4-99
TLWQRPIVKVKIGGKQIEALLDTGADDTVLEEITLPGKWKPKLIGGIGGLVRVRQYDQVP
IEICGHKVISSVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005