<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_27 GBS_27 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+IDV NA
2 3TC+D4T+IDV NA
3 3TC+D4T+EFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D L10I, E35D, M36I, R41K, Q61E, I62V, L63P, I64L, I93L  
>GBS_27| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADNTVLEDINLPGKWKPKMIGGIGGFIKVRQYDEVP
LEICGHKAIGTVLVGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V D67G, K219E     S68G, T69N, D123DE, I135T, S162C, Q174QR, G196E, R211K T84P, D113H
>GBS_27| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKGGNRWRKLVDFRELNKRPQDFWEVQLGIPHP
AGLKKKKSVTVLDVGHAYFSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKRNPDIVIYQYVDDLYVGSDLEIEQHRTKIEELRQHLLKWGFTTP
DEKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005