<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_25 GBS_25 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+NFV+NVP+SQV NA
2 ABC+EFV+LPV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   Y181C, G190A K101H, V108I K43E, E44A, E53D, W88C, K103R, K122E, D123DN, I135T, S162Y, V189I, T200A, Q207E, H208Y, R211K, H221Y  
>GBS_25| codons 38-247
CTELEEAGKISKIGPDNPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFCEVQLGIPHP
AGLHKRKSVTILDVGDAYFSVPLDENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDIVICQYMDDLYIASDLEIGQHRAKIEELREYLWKWGFYTP
DKKYQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I54V, V82A, I84V, L90M V11VI, L33F, K43T, T74P L10I, I13V, I15V, Q18H, L19I, K20R, E35D, M36I, K55N, I62V, L63P, I64V, A71V, Q92R  
>GBS_25| codons 4-99
TLWQRPIITVKVGGHIREALLDTGADDTIFEDINLPGRWTPKIIGGIGGFVNVRQYDQVP
VEICGHKVIGPVLVGPTPANVIGRNLMTRIGCTLNF

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005