<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_22 GBS_22 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 DDI NA
3 DDC NA
4 AZT+DDI NA
5 3TC+AZT+SQV NA
6 3TC+AZT+NFV NA
7 3TC+EFV+TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F V75VL, K219Q Y181YC, G190CS A98G, V108VI K43E, T69N, K102KQ, I167V, V179I, G196E, H208Y, R211RK, L228H  
>GBS_22| codons 38-247
CTELEEEGKISKIGPENPYNTPVFAIKKKNSNRWRKLLDFRELNKRTQDFWEVQLGIPHP
GGLKQKKSVTILDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKVLEPFRKQNPDIIICQYVDDLYVSSDLEIEQHRTKIEELRQYLLKWGFFTP
DQKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   K20V, L63P, A71I, T74S, V77I, I93L  
>GBS_22| codons 4-99
TLWQRPLVTIKIGGQLVEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYDQIP
IEICGHKIIGSVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005