<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_20 GBS_20 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+IDV NA
2 3TC+D4T+NFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S   L10V, I13V, I15IV, G16A, K20T, K45KR, I62V, I64V, V77I  
>GBS_20| codons 4-99
TLWQRPVVTVKVAGQLTEALLDTGADDTVLEEMNLPGRWKPRMIGGIGGFIKVRQYDQVL
VEICGHKAIGTVLIGPTPVNIIGRSLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V K219Q     V118I, K122E, I135T, S162SN, Q174H, F214L  
>GBS_20| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQNSMTKILEPFRKHNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005