<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_18 GBS_18 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   R57RK, L63P, A71V, I72E, V77I, I93L  
>GBS_18| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVKQYDQIP
IEICGHKVEGTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, T215F V75VAIT, K219Q K101P, G190A   T39A, S48E, V60VI, K103R, I135M, S162N, V189I, G196E, T200TA, R211K, D218E, L228H, Q242H  
>GBS_18| codons 38-247
CAELEKEGKIEKIGPENPYNTPIFAIKKKNSTRWRKITDFRELNKRTQDFWEVQLGIPHP
AGLPKRKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSP
AIFQNSMTKILEPFRKQNPDIVIYQYVDDLYIASDLEIEQHRAKIEELRQHLLKWGFFTP
EQKHQKEPPFHWMGYELHPDKWTVHPIVLP

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005