<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_17 GBS_17 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+NFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D I13V, K14R, I15V, K20R, E35D, M36I, R41K, L63P  
>GBS_17| codons 4-99
TLWQRPLVTVRVGGQLREALLDTGADNTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIP
IEICGHKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219Q     K122E, I135T, D177G, I195T, T200A, Q207QK, F214L, D218E  
>GBS_17| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPGIVIYQYMDDLYVGSDLETGQHRAKIEELRKHLLRWGLTTP
EQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005