<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_16 GBS_16 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI NA
2 3TC+AZT NA
3 3TC+AZT+SQV NA
4 3TC+AZT+NFV NA
5 Unknown 1

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   L10I, K20T, K55R, L63P, I64V, V77I, I93L  
>GBS_16| codons 4-99
TLWQRPIVTIKIGGQLTEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIRVRQYDQIP
VEICGHKAIGTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V       I135T, Q207A, R211K  
>GBS_16| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRAHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005