<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_15 GBS_15 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 RTI NA
2 AZT+DDC+SQV 106
3 AZT+DDC+NFV 106
4 3TC+AZT+NFV 106

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   L10V, I15V, K20IMV, M36MV, N37S, R41RK, I62V, L63P, A71T, T74S, V75I  
>GBS_15| codons 4-99
TLWQRPVVTIKVGGQLVEALLDTGADDTVLEEVSLPGKWKPKIIGGIGGFIKVRQYDQVP
IEICGHKTIGSILVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, L210W, T215Y K219KR K103N   E44ED, K49R, V60I, V118I, K122E, I135IT, G196E, Q207E  
>GBS_15| codons 38-247
CTELEKDGKISRIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIEQHRTKIEELREHLWRWGFYTP
DRKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005