<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_13 GBS_13 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NFV NA
2 3TC+AZT+NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I T12N, I15V, L19I, L63T, V82I  
>GBS_13| codons 4-99
TLWQRPLINIKVGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQIT
IEICGHKAIGTVLVGPTPINIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215TNSY   K103N   V118I, I135T, I142T, G196E, F214L, V245L  
>GBS_13| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGLYTP
DKKHQKEPPFLWMGYELHPDKWTVQPILLP

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005