<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_11 GBS_11 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 DDI NA
3 3TC+D4T NA
4 3TC+D4T+IDV NA
5 3TC+AZT+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219E V106A F227L T69S, V118VI, D123E, I135T, S162C, I202IV, F214L  
>GBS_11| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSSRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSATVLDVGDAYFSIPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKVEELRQHLLRWGLTTP
DEKHQKEPPLLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L24I L10I, I15V, G16GR, E35D, M36MI, R57RK, L63P, A71V, I93IL  
>GBS_11| codons 4-99
TLWQRPIVTIKVRGQLKEALIDTGADDTVLEDINLPGRWKPKMIGGIGGFVKVKQYDQIP
IEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005