<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GBS_10 GBS_10 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 DDI NA
3 3TC+AZT+RTV NA
4 3TC+AZT+LPV NA
5 DDI+NVP+TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R A62AV, T215C Y181C, G190GA   R83K, V90VI, I135T, S162Y, R211EK  
>GBS_10| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKRKDSTKWRKLVDFRELNKKTQDFWEIQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDIVICQYMDDLYVASDLEIGQHRTKIEELRQHLLKWGFCTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TS, I15IV, L19IT, E35D, N37NDEK, L63P  
>GBS_10| codons 4-99
TLWQRPLVSIKVGGQTKEALLDTGADDTVLEDMKLPGRWKPKMIGGIGGFIKVRQYDQIP
IEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Garcia-Bujalance, S Comparison between sequence analysis and a line probe assay for testing genotypic resistance of human immunodeficiency virus type 1 to antiretroviral drugs. J Clin Microbiol, 2005