<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG347_0068 068_PR_w21 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 26
2 None 16
3 3TC+APV+AZT 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, Q18QR, N37S, L63S, V77I, I93L  
>068_PR_w21| codons 1-99
PQITLWQRPIVTIKIGGRLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QISIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, K122E, K166R, I202V, Q207E, L210F, R211K  
>068_RT_w21| codons 1-261
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELREHLFKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLV

References
Author Title Citation
Murphy, RL Treatment with amprenavir alone or amprenavir with zidovudine and lamivudine in adults with human immunodeficiency virus infection. AIDS Clinical Trials Group 347 Study Team. J Infect Dis, 1999