<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG347_0043 043_PR_w20 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+APV+AZT 20

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IL   L10I, L63T, I93IL  
>043_PR_w20| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFLKVRQYD
QITIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       I135V, K173KE, R211Q Q222QK
>043_RT_w20| codons 1-261
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLQWGFTTPDKKHKKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLV

References
Author Title Citation
Murphy, RL Treatment with amprenavir alone or amprenavir with zidovudine and lamivudine in adults with human immunodeficiency virus infection. AIDS Clinical Trials Group 347 Study Team. J Infect Dis, 1999