<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG347_0039 039_PR_w0 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 6

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I T12P, L19I, N37S, L63P, I64IL, H69N, A71V, P79S, I93L R87RS
>039_PR_w0| codons 1-99
PQITLWQRPLVPIKIGGQIKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIPLEICGNKVIGTVLVGSTPVNIIGSNLLTQLGCTLNF

References
Author Title Citation
Murphy, RL Treatment with amprenavir alone or amprenavir with zidovudine and lamivudine in adults with human immunodeficiency virus infection. AIDS Clinical Trials Group 347 Study Team. J Infect Dis, 1999