<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG347_0035 035_PR_w17 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 APV 17

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V L10FI I13IV, N37S, R41K, I62V, I64IV, I72M  
>035_PR_w17| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVRQYD
QVLVEICGHKAMGTVLVGPTPVNVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179D K102R, I142V, Q174A, I202V, Q269*, A272P, K277R, T286A C280L
>035_RT_w17| codons 1-287
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKANPDIDI
YQYMDDLYVGSDLEIGQHRTKVEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWAS*IYPGIKVRQLLKLLRGAK

References
Author Title Citation
Murphy, RL Treatment with amprenavir alone or amprenavir with zidovudine and lamivudine in adults with human immunodeficiency virus infection. AIDS Clinical Trials Group 347 Study Team. J Infect Dis, 1999