<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG347_0293 293_PR_w22 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 65
2 None 17
3 AZT 35
4 None 11
5 DDI 6
6 None 6
7 3TC+APV+AZT 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IM   Q7QR, K14KR, E21EG, L63Q, I72IV  
>293_PR_w22| codons 1-99
PQITLWRRPLVTIRIGGQLKGALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFMKVRQYD
QIQIEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MIV       E28EA, R83K, D123E, I159V, V179A, T200A P59T
>293_RT_w22| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALVEICTEMEKEGKISKIGPENPYNTTV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAVFQSSMTKILEPFRKQNPDIAI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLP

References
Author Title Citation
Murphy, RL Treatment with amprenavir alone or amprenavir with zidovudine and lamivudine in adults with human immunodeficiency virus infection. AIDS Clinical Trials Group 347 Study Team. J Infect Dis, 1999