<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG347_0131 131_PR_w12 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 195
2 AZT+DDI 64
3 3TC+APV+AZT 11

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37E, L63S, I64V, E65D  
>131_PR_w12| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMELPGRWKPKMIGGIGGFIKVRQYD
QISVDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   Y188YH   K11KE, K20R, W88F, I135IL, T200V, R211K, F214L, V245M N57ND, T58TA
>131_RT_w12| codons 1-261
PISPIETVPVELKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYDAPV
FAIKKKDSTKWRKLVDFRELNKRTQDFFEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLHVGSDLEIGQHRVKIEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLV

References
Author Title Citation
Murphy, RL Treatment with amprenavir alone or amprenavir with zidovudine and lamivudine in adults with human immunodeficiency virus infection. AIDS Clinical Trials Group 347 Study Team. J Infect Dis, 1999