<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DB_SI3493-03 SI3493-03 Slovenia 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, I15V, E35D, M36I, R41K, L63P, H69K, L89M, T91I  
>SI3493-03| codons 1-99
PQITLWQRPIVTVKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLIQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179D I5V, E6D, K11T, K20R, V35T, T39K, K43EQ, V60I, S68G, V111I, K122E, D123N, S163T, K173I, Q174K, D177E, I178M, T200I, Q207A, R211S, K238R, V245E, L282C, T286A, E291D, V292I, I293V, P294Q, E312T, V314A, S322L, I329V, K331N  
>SI3493-03| codons 1-335
PISPVDTVPVTLKPGMDGPRVKQWPLTEEKIKALTEICKEMEQEGKISKIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDIGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSTMTKILEPFRIKNPEMDI
YQYMDDLYVGSDLEIGQHRIKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKCLRGAKALTDIVQLTEEAE
LELAENREILKTPAHGVYYDPLKDLIAEVQNQGQG

References
Author Title Citation
Babic, DZ Prevalence of antiretroviral drug resistance mutations and HIV-1 non-B subtypes in newly diagnosed drug-naive patients in Slovenia, 2000-2004. Virus Res, 2006