<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SM_02YE512 02YE512 Yemen 2002 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, E35D, M36I, N37K, R41I, R57K, L63P, H69K, K70R, I72V, L89M G49R
>02YE512| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEDIKLPGIWKPKMIGRIGGFIKVKQYD
QIPIEICGKRAVGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11A, V35T, T39N, K122E, D123G, T139L, K166R, E169D, K173A, Q174K, D177E, V179T, G196E, T200A, Q207A  
>02YE512| codons 1-238
PISPIETVPVALKPGMDGPKVKQWPLTEEKIKALTEICNEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNELPGIRYQYNVLPQGWKGSPAIFQSSMTRILDPFRAKNPEITI
YQYMDDLYVGSDLEIEQHRAKIEELRAHLLRWGFTTPDKKHQKEPPFLWMGYELHPDK

References
Author Title Citation
Saad, MD HIV type 1 strains common in Europe, Africa, and Asia co-circulate in Yemen. ARHR, 2005