<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SM_01YE394 01YE394 Yemen 2001 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36I, R41K, L63S, H69K, L89M, I93L  
>01YE394| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35T, T39E, S48T, A98S, K122E, D123S, K173A, D177E, T200A, Q207E, H208Y, R211K N57T
>01YE394| codons 1-238
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYTTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREYLLKWGFTTPDKKHQKEPPFLWMGYELHPDK

References
Author Title Citation
Saad, MD HIV type 1 strains common in Europe, Africa, and Asia co-circulate in Yemen. ARHR, 2005