<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NL_KHM_HM24 KHM_HM24 Cambodia 2004 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TA, I15V, K20R, E35D, M36I, R41K, Q61E, H69K, L89M, I93L  
>KHM_HM24| codons 1-99
PQITLWQRPLVAIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
EILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35T, T39N, K122E, D123S, S162C, Q174R, D177E, I178M, Q207N, R211Q, V245E, K249R  
>KHM_HM24| codons 6-250
DTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICNEMEKEGKISKIGPENPYNTPVFAIKK
KDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFR
KYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKRNPEMVIYQYMD
DLYVGSDLEIGQHRTKIEELRNHLLQWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIE
LPERD

References
Author Title Citation
Ly, N Characterization of mutations in HIV type 1 isolates from 144 Cambodian recently infected patients and pregnant women naive to antiretroviral drugs. ARHR, 2005
Ly, N Reverse transcriptase mutations in Cambodian CRF01_AE isolates after antiretroviral prophylaxis against HIV Type 1 perinatal transmission. ARHR, 2007