<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
OK_TC007803 TC007803 Uganda 2004 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20KQ, E35D, M36I, R57K, D60E, I62V, L63P, H69K, K70R, L89M L33LS
>TC007803| codons 1-99
PQITLWQRPLVTVKIGGQLQEALLDTGADDTVSEDINLPGRWKPKMIGGIGGFIKVKQYE
QVPIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K43R, S48E, K49R, K122E, E169D, K173S, Q174K, D177E, I178L, V179I, T200A, Q207D, V245Q, A272P, E291D, I293V, E297K, K311Q, E312D  
>TC007803| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEREGKIERIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRSKNPELII
YQYMDDLYVGSDLEIGQHRAKIEELRDHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDVVPLTKEAE
LELAENREILQDPVHGVYYDPSKDLIAEIQKQG

References
Author Title Citation
K'Aluoch, OF Characterization of HIV-1 subtypes and recombinants in a Uganda cohort by use of the gag, nef and pol genes. Direct Genbank Submission, 2005