<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
OK_TC008303 TC008303 Uganda 2004 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13IV, K20R, M36I, R41K, I62V, I64V  
>TC008303| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QVLVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, V60I, D177E, I178M, G196E, T200M, Q207E, R211K, V245E, D250E, A272P, L282C, I293V, I326V  
>TC008303| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIEQHRMKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKCLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQ

References
Author Title Citation
K'Aluoch, OF Characterization of HIV-1 subtypes and recombinants in a Uganda cohort by use of the gag, nef and pol genes. Direct Genbank Submission, 2005