<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
OK_TC010103 TC010103 Uganda 2001 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L33LV, R41K, D60E, Q61E, L63P  
>TC010103| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVVEEMNLPGKWKPKMIGGIGGFIKVRQYE
EIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K49R, V60I, D121C, K122E, D123DE, D177E, I178M, T200I, Q207G, R211K, E248N, L282C, L283I, T286A Y318H
>TC010103| codons 1-320
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
CEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPNKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKCIRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVHYD

References
Author Title Citation
K'Aluoch, OF Characterization of HIV-1 subtypes and recombinants in a Uganda cohort by use of the gag, nef and pol genes. Direct Genbank Submission, 2005