<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
OK_TC024604 TC024604 Uganda 2004 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, L19P, K20I, M36I, R41K, H69K, L89M  
>TC024604| codons 1-99
PQITLWQRPIVTIKIGGQPIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, V60I, K64R, K102Q, D121A, K122E, S162Y, K173S, Q174K, D177E, T200A, Q207A, R211S, V245Q, T286A, E291D, I293V, E312D  
>TC024604| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPI
FAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
AEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRSKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVPLTEEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
K'Aluoch, OF Characterization of HIV-1 subtypes and recombinants in a Uganda cohort by use of the gag, nef and pol genes. Direct Genbank Submission, 2005