<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
OK_TC025204 TC025204 Uganda 2004 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11N, V35T, V60I, S68G, D121H, K122E, I135T, K173S, Q174K, D177E, G196E, T200A, Q207A, R211S, V245Q, T286A, E291D, I293V, P294A  
>TC025204| codons 1-334
PISPIETVPVNLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIVI
YQYMDDLYVGSDLEIEQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVALTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, L19I, E35D, M36I, R41K, R57K, L63LP, H69K, L89M  
>TC025204| codons 1-99
PQITLWQRPLVTIRIGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
K'Aluoch, OF Characterization of HIV-1 subtypes and recombinants in a Uganda cohort by use of the gag, nef and pol genes. Direct Genbank Submission, 2005