<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PG_GT652 GT652 Equatorial Guinea 1998 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        S3R, E6K, K11T, V35T, T39R, K43E, S68G, K122E, D123N, I135T, S162H, K173S, V179I, T200A, Q207A  
>GT652| codons 1-212
PIRPIKTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICREMEEEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRSQNPDIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLRW

References
Author Title Citation
Gonzalez, P Epidemiological and molecular characteristics of HIV and HTLV infection in Equatorial Guinea, 1996-1998. Direct Genbank Submission, 2003