<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PG_GT576 GT576 Equatorial Guinea 1998 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E40D, K49R, V60I, V118I, I135T, T165I, D177E, I178L, T200I, E204K, Q207E, F214L, V245T  
>GT576| codons 1-249
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPELVI
YQYMDDLYVGSDLEIGQHRIKIEKLREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEK

References
Author Title Citation
Gonzalez, P Epidemiological and molecular characteristics of HIV and HTLV infection in Equatorial Guinea, 1996-1998. Direct Genbank Submission, 2003