<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IP_97CIRMF58 97CIRMF58 Gabon 1997 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, E35D, M36I, N37D, R41K, L63T, I64M, H69K, I72T, L89M  
>97CIRMF58| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QITMEICGKKATGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K22N, V35T, E36D, D123E, I135V, S162A, K173T, Q174R, D177E, I195T, T200A, Q207E, R211N, E233G  
>97CIRMF58| codons 1-240
PISPIETVPVKLKPGMDGPKVNQWPLTEEKIKALTDICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTRNPEIVI
YQYMDDLYVGSDLETGQHRAKIEELREHLLNWGFTTPDKKHQKEPPFLWMGYGLHPDKWT

References
Author Title Citation
Pandrea, I Analysis of partial pol and env sequences indicates a high prevalence of HIV type 1 recombinant strains circulating in Gabon. ARHR, 2002