<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BB_02ET_288 02ET_288 Ethiopia 2002 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, M36I, R41K, L63H, H69K, I93L  
>02ET_288| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIHIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39E, K122E, D123S, I135T, K173A, Q174K, D177E, Q207E, R211K, V245Q, D250E, A272P, T286A, E291D, V292I, I293V, Q334D, G335D, R356K, M357R, G359T, Q367L, T377L, T386I, K390R, A400T, E404D, V435A, L452I, V466I, D471E, H483Q, L491S, L517V, S519N, Q524E, K530R, A534S, A554S  
>02ET_288| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGDDQWTYQIYQEPFKNLKTGKYAKRRTA
HTNDVKLLTEAVQKIALESIVIWGKIPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKIGKAGYVTDRGRQKIVSLTETTNQKTELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESEVVNQIIEELIKKERVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Brown, BK Biologic and genetic characterization of a panel of 60 human immunodeficiency virus type 1 isolates, representing clades A, B, C, D, CRF01_AE, and CRF02_AG, for the development and assessment of candidate vaccines. J Virol, 2005