<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA25695 CA59667 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV 8
2 3TC+ATV+D4T 35
3 3TC+D4T+NVP 50

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KR, M184V   K103S, G190A   V35VI, R83K, V179VI, T200AE, E204ED, R211K, F214L, Y271YH, A272P, I293V, E297AT, A327V  
>CA59667| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKSKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVASDLEIGQHREKIEDLRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIHPGIKVKQLCKLLRGTKALTEVVPLTTEAE
LELAENREILKEPVHGVYYDPSKDLIVEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50L   T4S, T12P, I13V, K14R, Q18H, K20T, E35DN, M36I, N37E, K70E, A71V, I93L L63KNT
>CA59666| codons 1-99
PQISLWQRPLVPVRIGGHLTEALLDTGADDTVLENIELPGRWKPKMIGGLGGFIKVRQYD
QITIEICGHEVIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009