<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA25596 CA59468 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 48
2 None 126
3 3TC+AZT+NFV 61
4 None 68
5 3TC+AZT+NFV 8

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   N37T, R41K, K43R, I62V, L63P, I64V, H69Y, V77I, Q92K, I93L  
>CA59468| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMTLPGKWRPKIIGGIGGFIKVRQYD
QVPVEICGYKAIGTVLIGPTPVNIIGRNLMTKLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K20R, D123E, I135T, I142V, A158AP, T200A, Q207H, F214L, R284K, I293V, E297K, K311R, Q334L, V365I, K390R, K395R, V435I, K451R, V466I, S468P, H483Y, Q547R  
>CA59469| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPPIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRHHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGTKALTEVVPLTKEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGLGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDIKQLTEAVQKIATESIVIWGKTPKFRLPIQRETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDGAANRETRLGKAGYVTDRGRQKIVPLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNERVDKLVSAGIRKVL

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009