<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA23820 CA59353 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 24

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   E6D, V106I, V118VI, K122P, S162Y, P176K, T200TA, I202V, F214L, E224D, V245E, A272P, K277R, E297A  
>CA59353| codons 1-301
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSITVLDVGDAYFSIPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNKDIVI
YQYMDDLYVGSDLEIGQHRAKVEELRQHLLRWGLTTPDKKHQKDPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTAEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G17E, N37NS, R57K, I62IV, L63P, V77VI  
>CA59352| codons 1-99
PQITLWQRPLVTIKIGEQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVKQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009