<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA21056 CA59339 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+AZT 52
2 D4T+DDI+EFV 60

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R   L100I, K103KN, Y188YFHL   M16MV, E36D, K122KE, R211E, H221HY, A272P, A288S, I293V, P294PS, K311KR, S322T, M357T, K366R E203EGKR
>CA59339| codons 1-368
PISPIETVPVKLKPGVDGPKVKQWPLTEEKIKALVDICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIGQHRTKIRELRQHLLEWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTEVVSLTEEAE
LELAENREILREPVHGVYYDPTKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVRQL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, R41K, D60E, I62V, L63P, I64V  
>CA59338| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDMNLPGKWKPKMIGGIGGFIKVRQYE
QVPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009