<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1834 CA59295 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 109
2 D4T+DDI+RTV 19
3 D4T+DDC+NFV+RTV 31
4 D4T+NFV+RTV 10
5 D4T+IDV+NFV+RTV 20
6 D4T+NFV 14
7 3TC+D4T+EFV+NFV 32
8 ABC+APV+D4T 63
9 D4T+IDV+NVP+RTV 27
10 AZT+DDI+LPV 130
11 ATV+DDI+NVP 22
12 3TC+ATV+DDI+RTV+TDF 69
13 DDI+DLV+APV+FTC+RTV+TDF 9

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, M184V, L210W, T215Y   K101E, Y181C, G190A V108VI E28EGKR, T39A, E44D, V118I, D123E, I135T, I178IM, T200A, Q207E, R211K, L228N, P294Q  
>CA59295| codons 1-304
PISPIETVPVKLKPGMDGPKVKQWPLTREKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTILDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
CQYVDDLYVASDLEIGQHRAKIEELREHLWKWGFYTPDKKHQKEPPFNWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIQLTEEAE
LELA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L76V, V82A L10F, L23I, L33F, Q58E I13V, R57K, D60E, L63P, A71V, I93L  
>CA59294| codons 1-99
PQITLWQRPFVTVKIGGQLKEAILDTGADDTVFEEMNLPGRWKPKMIGGIGGFVKVKEYE
QIPIEICGHKVIGTVVVGPTPANIIGRNLLTQLGCTLNF

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  E138D S17N, L28I, L45I, L101I, T124A, T125A, F181L  
>CA124162| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNIPPVVAKEIVASCDKCQIKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSN
FTSAAVKAACWWAGIKQDFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
LIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012