<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1443 CA59286 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 22
2 DDC 64
3 D4T 30
4 D4T+IDV 6
5 3TC+D4T+IDV 79
6 3TC+D4T+DLV+NFV+SQV 55
7 3TC+D4T+NFV+SQV 196
8 3TC+ABC+APV+D4T+DDI+LPV 65
9 3TC+ABC+APV+ATV+DDI+RTV+TDF 22
10 3TC+ABC+APV+ATV+RTV 48
11 3TC+ABC+ATV+APV+RTV 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46L, I54LV, V82A, I84V L24I, L33F L10I, I13V, I15IV, L19LV, K43E, D60E, L63P, A71V, I72V  
>CA59286| codons 1-99
PQITLWQRPIVTVKVGGQVKEALIDTGADDTIFEEMNLPGRWEPKLIGGIGGFVKVRQYE
QIPIEICGHKVVGTVLVGPTPANVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y       K49KR, V60VI, V118I, D123E, I135T, T165TI, D177E, V179I, V245E, A272S, K277R N136NT
>CA59287| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSTTNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPEIII
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYSGIKVRQLCKLLRGTKALTEVIPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010