<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4426 CA59265 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 164
2 AZT+D4T+SQV 13
3 3TC+ABC+APV 23
4 D4T+DDI+EFV+NFV 39
5 DDI+EFV+NFV 248

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y K219KE L100I, K103N   K64R, K122E, I135V, S162C, K173R, Q174K, D177E, I178L, R211K, A272P, G333E, T338S  
>CA59265| codons 1-345
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRRKNPELVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEQGQWSYQIYQEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   L10I, L19T, N37S, D60E, L63P, A71V  
>CA59264| codons 1-99
PQITLWQRPIVTIKIGGQTKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFVKVRQYE
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009