<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4307 CA59246 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 61
2 3TC+D4T+IDV 35
3 DDI+RTV+SQV 61
4 D4T+DDI+RTV+SQV 44
5 3TC+D4T+IDV+RTV 13
6 3TC+D4T+IDV+NVP+RTV 74
7 None 22
8 ABC+APV+AZT+DDI+LPV 52
9 3TC+APV+AZT+DDI+LPV 31
10 3TC+D4T+LPV+TDF 65
11 3TC+D4T+RTV+T20+TDF+TPV 76

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I84V Q58E L10V, I13V, I15V, L19I, K20T, M36I, L63P, I64V, Q92K  
>CA59246| codons 1-99
PQITLWQRPVVTVKVGGQITEALLDTGADDTILEEINLPGRWKPKIVGGIGGFIKVREYD
QIPVEICGHKAIGTVLVGPTPVNVIGRNLLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215Y   K103N   V118I, K122E, D177N, I178M, T200A, K277R  
>CA59247| codons 1-285
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPNMVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRG

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010