<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1456 CA59237 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 30
2 AZT+DDC 43
3 3TC+D4T 31
4 3TC+AZT 13
5 3TC+AZT+SQV 22
6 3TC+AZT+IDV 65
7 3TC+AZT+NFV 9
8 3TC+AZT+NVP 44
9 D4T+IDV+RTV 42
10 ABC+APV+D4T+RTV+SQV 206
11 DDI+FTC+RTV+TDF+TPV 65
12 DDI+FTC+LPV+T20+TDF 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219DN Y188L   V35I, T39A, E44D, V60I, V118I, K122E, I135T, S162C, G196E, T200A, E203K, R211K, K223E, L228HR, A272P, A288AS  
>CA59237| codons 1-304
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEKDGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLLVGSDLEIEQHRAKIKELRQHLWKWGFYTPDNKHQEEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTEVIPLTEEAE
LELA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, I84V, L90M L33F, F53FL, G73T L10IV, E35D, M36MI, N37S, K55R, R57RK, L63P, I64V, I66V, A71IV, P79PA, I93IL  
>CA59236| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTIFEDISLPGRWKPKIVGGIGGLLRVKQYD
QIPVEVCGHKVITTVLVGATPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY Genotypic predictors of human immunodeficiency virus type 1 drug resistance. PNAS, 2006
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012