<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4323 CA59233 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 87
2 DDI 148
3 AZT+DDC+DLV 83
4 RTV+SQV 35
5 D4T+EFV+RTV+SQV 31
6 3TC+ABC+APV+D4T 178
7 3TC+ABC+APV 91
8 IDV+RTV+TDF 39
9 APV+RTV+TDF 13

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y V75T, K219D K103N L234I, Y318F V35I, T39A, K43E, K64R, V118I, K122E, G196E, T200A, E203K, Q207E, D218E, F227Y, L228H, T286A, I293V, S322A, G335D  
>CA59233| codons 1-339
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEEEGKISKIGPENPYNTPV
FAIRKKNSTKWRKITDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRAKIKELREHLWRWGFYTPEDKHQKEPPYHWMGYEIHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVFYDPAKDLIAEIQKQGQDQWTY

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I54L, I84V, L90M L10F, V11I, L33F, Q58E, L89V I13V, K20T, T31TA, E35D, M36I, R41K, D60E, I62V, L63P, A71V, V77I, P79H W42W*
>CA59232| codons 1-99
PQITLWQRPFITVKIGGQLTEALLDTGADDAIFEDINLPGK*KPKMIGGIGGFLKVREYE
QVPIEICGHKVIGTVLIGHTPVNVIGRNVMTQIGCTLNF

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012