<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8413 CA59216 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+RTV+SQV 169
2 D4T+DDI+EFV 228

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, M36L, N37T, I62V, L63P, I72V, V75I T74NS
>CA59216| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEELTLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAVGSILVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, L210W, T215Y K219KR L100LI, K103N P225PH V35M, T39A, S68SG, V118I, K122E, I135T, A158T, D177E, E203D, Q207E, R211K, A272P, K277R, T286A, E297K  
>CA59217| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPTIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIDELREHLWKWGFYTPDRKHQKEHPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTKEAE
L

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009